| Cat.No.: | PE-2706 |
| Background: | RNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing. May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection. Beside its function in pre-mRNA splicing, plays also a role in the regulation of translation. Isoform 5 has a reduced affinity for RNA. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | brPTB/FLJ34897/MIBP |
| Tag: | GST |
| Amino Acid Sequence: | MVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGK VTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHK ELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTP |
| Sequence Similarities: | Contains 4 RRM (RNA recognition motif) domains. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 35 to 175 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0045 | PTP1B Monoclonal Antibody | Inquiry |
| EAb-0046 | PTP1B Polyclonal Antibody | Inquiry |
| EAb-0047 | PTP1B Polyclonal Antibody | Inquiry |
| EAb-0310 | PTBP1 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0196 | Human PTCHD2 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| PTBP1 | PTBP2 | PTCHD2 | PTP1B |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.