Recombinant Human PTBP2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2706
Background:  RNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing. May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection. Beside its function in pre-mRNA splicing, plays also a role in the regulation of translation. Isoform 5 has a reduced affinity for RNA.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  brPTB/FLJ34897/MIBP
Tag:  GST
Amino Acid Sequence:  MVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGK VTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHK ELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTP
Sequence Similarities:  Contains 4 RRM (RNA recognition motif) domains.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 35 to 175
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Antibodies
EAb-0045 PTP1B Monoclonal Antibody Inquiry
EAb-0046 PTP1B Polyclonal Antibody Inquiry
EAb-0047 PTP1B Polyclonal Antibody Inquiry
EAb-0310 PTBP1 Polyclonal Antibody Inquiry
◆ Cell Lines
CL-0196 Human PTCHD2 Knockout Cell Line Inquiry
Related Gene / Proteins
PTBP1 PTBP2 PTCHD2 PTP1B

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart