Recombinant Human PRPF31 protein


  • Specification
  • Related Products
Cat.No.:  PE-2704
Product Name:  Recombinant Human PRPF31 protein
Background:  Involved in pre-mRNA splicing. Required for U4/U6.U5 tri-snRNP formation.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  DKFZp566J153/hPrp 31/hPrp31
Tag:  GST
Amino Acid Sequence:  GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTA SSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST
Sequence Similarities:  Belongs to the PRP31 family.Contains 1 Nop domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 400 to 499
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.