Recombinant Human KMT1E / SETDB1 protein (Tagged)


  • Specification
  • Related Products
Cat.No.:  PE-2646
Background:  Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. H3 'Lys-9' trimethylation is coordinated with DNA methylation. Probably forms a complex with MBD1 and ATF7IP that represses transcription and couples DNA methylation and histone 'Lys-9' trimethylation. Its activity is dependent on MBD1 and is heritably maintained through DNA replication by being recruited by CAF-1. SETDB1 is targeted to histone H3 by TRIM28/TIF1B, a factor recruited by KRAB zinc-finger proteins.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  37 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  Q15047
Alternative Names:  AU022152/EC 2.1.1.43/ERG-associated protein with SET domain
Tag:  GST
Amino Acid Sequence:  IAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIF FDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMV LL
Sequence Similarities:  Belongs to the histone-lysine methyltransferase family. Suvar3-9 subfamily.Contains 1 MBD (methyl-CpG-binding) domain.Contains 1 post-SET domain.Contains 1 pre-SET domain.Contains 1 SET domain.Contains 2 Tudor domains.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 247 to 348
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart