Cat.No.: | PE-2641 |
Product Name: | Recombinant Human CIRP protein |
Background: | Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed. |
Applications: | SDS-PAGE; ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 45 kDa including tags |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.3% Glutathione |
Accession#: | Q14011 |
Alternative Names: | A18 hnRNP/A18HNRNP/cirbp |
Amino Acid Sequence: | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG FVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGG RGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGG YSDRSSGGSYRDSYDSYATHNE |
Sequence Similarities: | Contains 1 RRM (RNA recognition motif) domain. |
Expression System: | Wheat germ |
Post Translational Modifications: | Methylated on arginine residues. Methylation of the RGG motifs is a prerequisite for recruitment into SGs.Phosphorylated by CK2, GSK3A and GSK3B. Phosphorylation by GSK3B increases RNA-binding activity to the TXN 3'-UTR transcript upon exposure to UV radiation. |
Protein Length: | Full length protein; 1 to 172 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0040 | Recombinant Human CITED2 Cell Lysate | Inquiry |
EL-0114 | Recombinant Human CITED1 293 Cell Lysate | Inquiry |
◆ Cell Lines | ||
CL-0387 | Human CIB1 Knockout Cell Line | Inquiry |
◆ Proteins & Enzymes | ||
PE-0389 | Recombinant Human CITED2, His-tagged | Inquiry |
PE-0390 | Recombinant Human CITED2, His-tagged | Inquiry |
Related Gene / Proteins | |||
CIB1 | CIRP | CITED1 | CITED2 |
CIZ1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools