| Cat.No.: | PE-2630 |
| Background: | DNA-binding protein that specifically binds heat shock promoter elements (HSE). Isoform HSF4A represses transcription while the isoform HSF4B activates transcription. |
| Applications: | ELISA; Western blot; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.3% Glutathione |
| Accession#: | Q9ULV5 |
| Alternative Names: | Cataract, Marner/CTM/Heat shock factor protein 4 |
| Amino Acid Sequence: | KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWR EVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC |
| Sequence Similarities: | Belongs to the HSF family. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated mainly on serine residues. Phosphorylation on Ser-298 promotes sumoylation on Lys-293.Isoform HSF4B is constitutively sumoylated. Sumoylation represses the transcriptional activity and is promoted by phosphorylation on Ser-298. HSFA is not sumoylated. |
| Protein Length: | Protein fragment; 120 to 219 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0027 | Human HSPBAP1 Knockout Cell Line | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0337 | BIIB021 | Inquiry |
| ◆ Antibodies | ||
| EAb-1959 | HSC70 / HSP7C Monoclonal Antibody | Inquiry |
| EAb-1960 | HSP72 Monoclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2336 | Recombinant Human HSPBAP1 protein | Inquiry |
| Related Gene / Proteins | |||
| HSC70 | HSF4 | HSP72 | Hsp90 |
| HSPBAP1 | hSSB1 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.
