Recombinant Human HSF4 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2630
Background:  DNA-binding protein that specifically binds heat shock promoter elements (HSE). Isoform HSF4A represses transcription while the isoform HSF4B activates transcription.
Applications:  ELISA; Western blot; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  37 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.79% Tris HCl, 0.3% Glutathione
Accession#:  Q9ULV5
Alternative Names:  Cataract, Marner/CTM/Heat shock factor protein 4
Amino Acid Sequence:  KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWR EVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
Sequence Similarities:  Belongs to the HSF family.
Expression System:  Wheat germ
Post Translational Modifications:  Phosphorylated mainly on serine residues. Phosphorylation on Ser-298 promotes sumoylation on Lys-293.Isoform HSF4B is constitutively sumoylated. Sumoylation represses the transcriptional activity and is promoted by phosphorylation on Ser-298. HSFA is not sumoylated.
Protein Length:  Protein fragment; 120 to 219
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Cell Lines
CL-0027 Human HSPBAP1 Knockout Cell Line Inquiry
◆ Bioactive Small Molecules
BSM-0337 BIIB021 Inquiry
◆ Antibodies
EAb-1959 HSC70 / HSP7C Monoclonal Antibody Inquiry
EAb-1960 HSP72 Monoclonal Antibody Inquiry
◆ Proteins & Enzymes
PE-2336 Recombinant Human HSPBAP1 protein Inquiry
Related Gene / Proteins
HSC70 HSF4 HSP72 Hsp90
HSPBAP1 hSSB1

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.