| Cat.No.: | PE-2629 |
| Background: | Binds specifically to the 3'-terminal U-tract of U6 snRNA. May be involved in pre-mRNA splicing. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 13 kDa including tags |
| Purity: | > 90 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.08% DTT, 0.32% Tris HCl, 40% Glycerol, 1.17% Sodium chloride |
| Accession#: | Q9Y333 |
| Alternative Names: | C6orf28/Chromosome 6 open reading frame 28/G7b |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMLFYSFFKSLVGKDVVVELKNDLSIC GTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADE VDTQLLQDAARKEALQQKQ |
| Sequence Similarities: | Belongs to the snRNP Sm proteins family. |
| Expression System: | E. coli |
| Post Translational Modifications: | Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Protein Length: | Full length protein; 1 to 95 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Research Kits | ||
| EKIT-0062 | Histone Demethylase LSD1 Activity/Inhibition Assay Kit | Inquiry |
| EKIT-0126 | LSD1 Inhibitor Screening Assay Kit | Inquiry |
| EKIT-0160 | LSD1 Demethylase Activity/Inhibition Fluorometric Assay Kit | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0111 | DDP-38003 dihydrochloride | Inquiry |
| BSM-0141 | GSK-LSD1 dihydrochloride | Inquiry |
| Related Gene / Proteins | |||
| LSD1 | LSD2 | LSM2 | LSM3 |
| LSM5 | LSM6 | LSP1 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.