Recombinant Human LSM2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2629
Product Name:  Recombinant Human LSM2 protein
Background:  Binds specifically to the 3'-terminal U-tract of U6 snRNA. May be involved in pre-mRNA splicing.
Applications:  SDS-PAGE; Mass Spectrometry
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  13 kDa including tags
Purity:  > 90 % SDS-PAGE. Purified using conventional chromatography techniques.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.08% DTT, 0.32% Tris HCl, 40% Glycerol, 1.17% Sodium chloride
Accession#:  Q9Y333
Alternative Names:  C6orf28/Chromosome 6 open reading frame 28/G7b
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMGSHMLFYSFFKSLVGKDVVVELKNDLSIC GTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADE VDTQLLQDAARKEALQQKQ
Sequence Similarities:  Belongs to the snRNP Sm proteins family.
Expression System:  E. coli
Post Translational Modifications:  Phosphorylated upon DNA damage, probably by ATM or ATR.
Protein Length:  Full length protein; 1 to 95
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.