Cat.No.: | PE-2629 |
Product Name: | Recombinant Human LSM2 protein |
Background: | Binds specifically to the 3'-terminal U-tract of U6 snRNA. May be involved in pre-mRNA splicing. |
Applications: | SDS-PAGE; Mass Spectrometry |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 13 kDa including tags |
Purity: | > 90 % SDS-PAGE. Purified using conventional chromatography techniques. |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.08% DTT, 0.32% Tris HCl, 40% Glycerol, 1.17% Sodium chloride |
Accession#: | Q9Y333 |
Alternative Names: | C6orf28/Chromosome 6 open reading frame 28/G7b |
Tag: | His |
Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMLFYSFFKSLVGKDVVVELKNDLSIC GTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADE VDTQLLQDAARKEALQQKQ |
Sequence Similarities: | Belongs to the snRNP Sm proteins family. |
Expression System: | E. coli |
Post Translational Modifications: | Phosphorylated upon DNA damage, probably by ATM or ATR. |
Protein Length: | Full length protein; 1 to 95 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Research Kits | ||
EKIT-0062 | Histone Demethylase LSD1 Activity/Inhibition Assay Kit | Inquiry |
EKIT-0126 | LSD1 Inhibitor Screening Assay Kit | Inquiry |
EKIT-0160 | LSD1 Demethylase Activity/Inhibition Fluorometric Assay Kit | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0111 | DDP-38003 dihydrochloride | Inquiry |
BSM-0141 | GSK-LSD1 dihydrochloride | Inquiry |
Related Gene / Proteins | |||
LSD1 | LSD2 | LSM2 | LSM3 |
LSM5 | LSM6 | LSP1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools