Recombinant Human LSM3 protein


  • Specification
  • Related Products
Cat.No.:  PE-2628
Background:  Binds specifically to the 3'-terminal U-tract of U6 snRNA.
Applications:  SDS-PAGE; Mass Spectrometry
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  14 kDa including tags
Purity:  > 90 % SDS-PAGE.Purified using conventional chromatography techniques.
Species:  Human
Formulation:  Constituents: 0.03% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride
Accession#:  P62310
Alternative Names:  lsm3/LSM3 homolog/LSM3 protein
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMGSMADDVDQQQTTNTVEEPLDLIRLSLDE RIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKS TKRNIPMLFVRGDGVVLVAPPLRVG
Sequence Similarities:  Belongs to the snRNP Sm proteins family.
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 102
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart