| Cat.No.: | PE-2625 |
| Background: | RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 38 kDa including tags |
| Purity: | > 90 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride |
| Accession#: | Q96DH6 |
| Alternative Names: | FLJ36569/MGC3245/Msi2 |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSMEANGSQGTSGSANDSQHDPGKMFIGG LSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDK VLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVK QYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINN KMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYG RGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGAN SPGPVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGY H |
| Sequence Similarities: | Belongs to the Musashi family.Contains 2 RRM (RNA recognition motif) domains. |
| Expression System: | E. coli |
| Post Translational Modifications: | Phosphorylated. |
| Protein Length: | Full length protein; 1 to 328 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0104 | Recombinant Human MSL1 Lysate | Inquiry |
| EL-0193 | Recombinant Human MSL3 293 Cell Lysate | Inquiry |
| EL-0194 | Recombinant Human MSL3 293 Cell Lysate | Inquiry |
| EL-0218 | Recombinant Human MSH6 293 Cell Lysate | Inquiry |
| EL-0227 | Recombinant Human MSL2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| MS4A7 | MSH2 | MSH3 | MSH5 |
| MSH6 | MSI2 | MSL1 | MSL2 |
| MSL3 | MSP58 | MST1 | MSY2 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.