| Cat.No.: | PE-2603 |
| Background: | CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits MYST4-dependent transcriptional activation. |
| Applications: | Western blot; SDS-PAGE; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | Q01196 |
| Alternative Names: | Acute myeloid leukemia 1/Acute myeloid leukemia 1 protein/alpha subunit core binding factor |
| Tag: | GST |
| Amino Acid Sequence: | RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQ YLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQF P |
| Sequence Similarities: | Contains 1 Runt domain. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with MYST3.Methylated. |
| Protein Length: | Protein fragment; 210 to 311 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0042 | Runx1/AML1-ETO Polyclonal Antibody | Inquiry |
| EAb-0313 | RUNX2 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0092 | Recombinant Human RUNX2 293 Cell Lysate | Inquiry |
| EL-0093 | Recombinant Human RUNX2 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0746 | Recombinant Human RUNX2 | Inquiry |
| Related Gene / Proteins | |||
| Runx1 | RUNX2 | RUVB2 | RUVBL1 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools