Recombinant Human RUNX1 / AML1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2603
Background:  CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits MYST4-dependent transcriptional activation.
Applications:  Western blot; SDS-PAGE; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  37 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  Q01196
Alternative Names:  Acute myeloid leukemia 1/Acute myeloid leukemia 1 protein/alpha subunit core binding factor
Tag:  GST
Amino Acid Sequence:  RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQ YLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQF P
Sequence Similarities:  Contains 1 Runt domain.
Expression System:  Wheat germ
Post Translational Modifications:  Phosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with MYST3.Methylated.
Protein Length:  Protein fragment; 210 to 311
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Antibodies
EAb-0042 Runx1/AML1-ETO Polyclonal Antibody Inquiry
EAb-0313 RUNX2 Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0092 Recombinant Human RUNX2 293 Cell Lysate Inquiry
EL-0093 Recombinant Human RUNX2 293 Cell Lysate Inquiry
◆ Proteins & Enzymes
PE-0746 Recombinant Human RUNX2 Inquiry
Related Gene / Proteins
Runx1 RUNX2 RUVB2 RUVBL1

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart