Recombinant Human SP100 protein


  • Specification
  • Related Products
Cat.No.:  PE-2598
Product Name:  Recombinant Human SP100 protein
Background:  May play a role in the control of gene expression.
Applications:  ELISA; SDS-PAGE; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl
Accession#:  P23497
Alternative Names:  DKFZp686E07254/FLJ00340/FLJ34579
Amino Acid Sequence:  MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLY DIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
Sequence Similarities:  Contains 2 HMG box DNA-binding domains.Contains 1 HSR domain.Contains 1 SAND domain.
Expression System:  Wheat germ
Post Translational Modifications:  Sumoylated. Sumoylation depends on a functional nuclear localization signal but is not necessary for nuclear import or nuclear body targeting.
Protein Length:  Protein fragment; 1 to 98
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.