Cat.No.: | PE-2596 |
Product Name: | Recombinant Human SP2 transcription factor protein |
Background: | Binds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites. |
Applications: | ELISA; SDS-PAGE; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 36 kDa including tags |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
Accession#: | Q02086 |
Alternative Names: | Kiaa0048/OTTHUMP00000196580/SP2 |
Amino Acid Sequence: | SPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSN ANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIIT |
Sequence Similarities: | Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 71 to 161 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0089 | Recombinant Human SP2 Cell Lysate | Inquiry |
◆ Cell Lines | ||
CL-0161 | Human SP1 Knockout Cell Line 2bp deletion | Inquiry |
CL-0169 | Human SP140L Knockout Cell Line | Inquiry |
CL-0170 | Human SP100 Knockout Cell Line 20bp deletion | Inquiry |
CL-0171 | Human SP110 Knockout Cell Line 7bp deletion | Inquiry |
Related Gene / Proteins | |||
SP1 | SP100 | SP110 | SP140 |
SP140L | SP2 | SP3 | SP6 |
SPDL1 | SPF30 | SPIN1 | SPOP |
SPT16 | SPT3 | Spt6 | SPTY2D1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools