| Cat.No.: | PE-2596 |
| Background: | Binds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites. |
| Applications: | ELISA; SDS-PAGE; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
| Accession#: | Q02086 |
| Alternative Names: | Kiaa0048/OTTHUMP00000196580/SP2 |
| Amino Acid Sequence: | SPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSN ANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIIT |
| Sequence Similarities: | Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 71 to 161 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0089 | Recombinant Human SP2 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0161 | Human SP1 Knockout Cell Line 2bp deletion | Inquiry |
| CL-0169 | Human SP140L Knockout Cell Line | Inquiry |
| CL-0170 | Human SP100 Knockout Cell Line 20bp deletion | Inquiry |
| CL-0171 | Human SP110 Knockout Cell Line 7bp deletion | Inquiry |
| Related Gene / Proteins | |||
| SP1 | SP100 | SP110 | SP140 |
| SP140L | SP2 | SP3 | SP6 |
| SPDL1 | SPF30 | SPIN1 | SPOP |
| SPT16 | SPT3 | Spt6 | SPTY2D1 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.