Recombinant Human SP2 transcription factor protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2596
Background:  Binds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites.
Applications:  ELISA; SDS-PAGE; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl
Accession#:  Q02086
Alternative Names:  Kiaa0048/OTTHUMP00000196580/SP2
Amino Acid Sequence:  SPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSN ANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIIT
Sequence Similarities:  Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 71 to 161
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.