Recombinant Human TRIM21/SS-A protein (Tagged)

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2592
Background:  E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)-like complex is shown to mediate ubiquitination of CDKN1B ('Thr-187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs.2.
Applications:  ELISA; SDS-PAGE; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  38 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.79% Tris HCl, 0.3% Glutathione
Accession#:  P19474
Alternative Names:  52 kDa ribonucleoprotein autoantigen Ro/SS-A/52 kDa Ro protein/52kD Ro/SSA autoantigen
Tag:  GST
Amino Acid Sequence:  QLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQS RKHRDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAIKRADW KKTVETQK
Sequence Similarities:  Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 RING-type zinc finger.
Expression System:  Wheat germ
Post Translational Modifications:  Autoubiquitinated; does not lead to its proteasomal degradation. Deubiquitinated by USP4; leading to its stabilization.
Protein Length:  Protein fragment; 68 to 175
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.