Recombinant Human Tristetraprolin/TTP protein


  • Specification
  • Related Products
Cat.No.:  PE-2591
Product Name:  Recombinant Human Tristetraprolin/TTP protein
Background:  mRNA-binding protein involved in post-transcriptional regulation of AU-rich element (ARE)-containing mRNAs. Acts by specifically binding ARE-containing mRNAs and promoting their degradation. Recruits deadenylase CNOT7 (and probably the CCR4-NOT complex) via association with CNOT1. Plays a key role in the post-transcriptional regulation of tumor necrosis factor (TNF). Plays a key role in the post-transcriptional regulation of tumor necrosis factor (TNF).
Applications:  Western blot; SDS-PAGE; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  62 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione
Accession#:  P26651
Alternative Names:  G0/G1 switch regulatory protein 24/G0S24/GOS24
Amino Acid Sequence:  MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGV TSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTT PSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKF YLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPP PGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCC PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE AGVFAPPQPVAAPRRLPIFNRISVSE
Sequence Similarities:  Contains 2 C3H1-type zinc fingers.
Expression System:  Wheat germ
Post Translational Modifications:  Phosphorylation by MAPKAPK2 increases its stability and binding to 14-3-3 proteins, leading to reduce its ARE affinity leading to inhibition of degradation of ARE-containing transcripts. Phosphorylated upon mitogen stimulation.
Protein Length:  Full length protein; 1 to 326
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.