Recombinant Human v-Myb protein


  • Specification
  • Related Products
Cat.No.:  PE-2589
Product Name:  Recombinant Human v-Myb protein
Background:  Strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
Applications:  Western blot; SDS-PAGE; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  38 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl
Accession#:  P10243
Alternative Names:  A-Myb/AMYB/MGC120059
Amino Acid Sequence:  KSLVLDNWEKEESGTQLLTEDISDMQSENRFTTSLLMIPLLEIHDNRCNL IPEKQDINSTNKTYTLTKKKPNPNTSKVVKLEKNLQSNCEWETVVYGKTE DQLIMTEQAR
Sequence Similarities:  Contains 3 HTH myb-type DNA-binding domains.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 625 to 734
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Synthetic Peptides
SP-0174 Human KAT8 / MYST1 / MOF peptide Inquiry
◆ Antibodies
EAb-0184 MYCBP Polyclonal Antibody Inquiry
EAb-0204 c-Myb Polyclonal Antibody Inquiry
EAb-0380 MYSM1 Polyclonal Antibody Inquiry
◆ Cell Lines
CL-0344 Human MYSM1 Knockout Cell Line 7bp deletion Inquiry
Related Gene / Proteins
MYB Myc MYCBP Myf-5
Myocilin MyoD MYSM1 MYST1
MYST3 Myt1

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.