Recombinant Human CIRP protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2585
Background:  Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.
Applications:  Mass Spectrometry; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  21 kDa including tags
Purity:  > 95 % SDS-PAGE. Purified using conventional chromatography techniques.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.32% Tris HCl, 0.02% DTT, 50% Glycerol, 0.58% Sodium chloride
Accession#:  Q14011
Alternative Names:  A18 hnRNP/A18HNRNP/cirbp
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMASDEGKLFVGGLSFDTNEQSLEQVFSKYG QISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFES RSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Sequence Similarities:  Contains 1 RRM (RNA recognition motif) domain.
Expression System:  E. coli
Post Translational Modifications:  Methylated on arginine residues. Methylation of the RGG motifs is a prerequisite for recruitment into SGs.Phosphorylated by CK2, GSK3A and GSK3B. Phosphorylation by GSK3B increases RNA-binding activity to the TXN 3'-UTR transcript upon exposure to UV radiation.
Protein Length:  Full length protein; 1 to 172
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.