| Cat.No.: | PE-2573 |
| Background: | Part of the CERF (CECR2-containing-remodeling factor) complex, which facilitates the perturbation of chromatin structure in an ATP-dependent manner. May be involved through its interaction with LRPPRC in the integration of cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling and cytokinesis. |
| Applications: | SDS-PAGE; Functional Studies |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 14 kDa including tags |
| Purity: | > 95 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol, 0.48% Tris |
| Accession#: | Q9BXF3 |
| Alternative Names: | Cat eye syndrome chromosome region candidate 2/Cat eye syndrome critical region protein 2/CECR2 |
| Tag: | His |
| Amino Acid Sequence: | MHHHHHHTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYY QIIKAPMDISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTK MSDNLERCFHRAMMKHFPGED |
| Sequence Similarities: | Contains 1 bromo domain. |
| Expression System: | E. coli |
| Protein Length: | Protein fragment; 430 to 543 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0054 | Human CECR2 Knockout Cell Line 13bp deletion | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0191 | Human CENPA peptide | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0219 | Recombinant Human CENPA 293 Cell Lysate | Inquiry |
| EL-0220 | Recombinant Human CENPA 293 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0340 | NVS-CECR2-1 | Inquiry |
| Related Gene / Proteins | |||
| CEACAM1 | CECR1 | CECR2 | CELF-5 |
| CELF-6 | CENH3 | CENPA | CENPB |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.