Recombinant Human AKNA protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2571
Background:  AKNA is a transcription factor that specifically activates the expression of the CD40 receptor and its ligand CD40L/CD154, two cell surface molecules on lymphocytes that are critical for antigen-dependent-B-cell development. It binds to A/T-rich promoters.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  AI597013/AKNA transcript F2/AT hook containing transcription factor
Tag:  GST
Amino Acid Sequence:  PTSAQPAAKWPPTASPPPARRHRHSIQLDLGDLEELNKALSRAVQAAESV RSTTRQMRSSLSADLRQAHSLRGSCLF
Expression System:  Wheat germ
Protein Length:  Protein fragment; 1363 to 1439
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Cell Lines
CL-0012 Human AKAP13 Knockout Cell Line Inquiry
◆ Proteins & Enzymes
PE-2571 Recombinant Human AKNA protein Inquiry
Related Gene / Proteins
AKAP13 AKNA

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.