| Cat.No.: | PE-2563 |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Bud31/BUD31 homolog (S. cerevisiae)/BUD31_HUMAN |
| Tag: | GST |
| Amino Acid Sequence: | MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG |
| Sequence Similarities: | Belongs to the BUD31 (G10) family. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 144 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Proteins & Enzymes | ||
| PE-2562 | Recombinant Human BUD31 protein | Inquiry |
| PE-2563 | Recombinant Human BUD31 protein | Inquiry |
| PE-2643 | Recombinant Human BUD31 protein | Inquiry |
| Related Gene / Proteins | |||
| BUD31 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.