| Cat.No.: | PE-2559 |
| Background: | Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 1110036E10Rik/AI875855/C1D |
| Tag: | GST |
| Amino Acid Sequence: | MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPL EQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEI TDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS |
| Sequence Similarities: | Belongs to the C1D family. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated by PRKDC. |
| Protein Length: | Full length protein; 1 to 141 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0028 | Human C17orf49 Knockout Cell Line | Inquiry |
| ◆ Antibodies | ||
| EAb-2048 | C17orf96 Polyclonal Antibody | Inquiry |
| EAb-2049 | C17orf96 phospho Ser15 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2349 | Recombinant Human C14orf169 / NO66 protein | Inquiry |
| PE-2557 | Recombinant Human C1D protein | Inquiry |
| Related Gene / Proteins | |||
| C14orf169 | C14ORF21 | C17orf42 | C17orf49 |
| C17orf96 | C1D | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.