Recombinant Human C1D protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2557
Background:  Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  1110036E10Rik/AI875855/C1D
Tag:  GST
Amino Acid Sequence:  NPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPK SKNASKVANKGKSKS
Sequence Similarities:  Belongs to the C1D family.
Expression System:  Wheat germ
Post Translational Modifications:  Phosphorylated by PRKDC.
Protein Length:  Protein fragment; 77 to 141
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.