| Cat.No.: | PE-2553 |
| Product Name: | Recombinant Human Chromodomain helicase DNA binding protein 9 |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 1810014J18Rik/9030205D12Rik/A330063D19Rik |
| Tag: | GST |
| Amino Acid Sequence: | MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQL LPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHN KTEIISTQGRILLASLKIL |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 119 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0147 | Recombinant Human CHAF1A 293 Cell Lysate | Inquiry |
| EL-0167 | Recombinant Human CHAF1B 293 Cell Lysate | Inquiry |
| EL-0211 | Recombinant Human CHD2 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0180 | Mouse Chd7 peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0199 | CHRDL1 Monoclonal Antibody (3H1-F6-A10) | Inquiry |
| Related Gene / Proteins | |||
| CHAF1A | CHAF1B | CHD1 | CHD2 |
| CHD3 | CHD4 | CHD5 | Chd7 |
| CHD8 | CHD9 | CHEK2 | CHRAC1 |
| CHRDL1 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
