| Cat.No.: | PE-2549 |
| Background: | This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Basic leucine zipper protein/cAMP responsive element binding protein 3/Clic AMP responsive element binding protein 3 |
| Tag: | GST |
| Amino Acid Sequence: | MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEV DDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKE GTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQI LKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLE EQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSD TRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLT RKGGWLPTGSPSVILQDRYSG |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 371 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0055 | Human CREBBP Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0094 | C646 | Inquiry |
| BSM-0124 | EML-425 | Inquiry |
| BSM-0150 | I-CBP112 (Hydrochloride) | Inquiry |
| ◆ Research Kits | ||
| EKIT-0122 | CBP bromodomain TR-FRET Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| CREB | CREB3 | crebbp | CRISP1 |
| CRISP3 | CRP | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.