Recombinant Human CREB3 protein


  • Specification
  • Related Products
Cat.No.:  PE-2548
Product Name:  Recombinant Human CREB3 protein
Background:  This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Basic leucine zipper protein/cAMP responsive element binding protein 3/Clic AMP responsive element binding protein 3
Tag:  GST
Amino Acid Sequence:  DPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAE PPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Expression System:  Wheat germ
Protein Length:  Protein fragment; 273 to 371
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Cell Lines
CL-0055 Human CREBBP Knockout Cell Line 1bp insertion Inquiry
◆ Bioactive Small Molecules
BSM-0094 C646 Inquiry
BSM-0124 EML-425 Inquiry
BSM-0150 I-CBP112 (Hydrochloride) Inquiry
◆ Research Kits
EKIT-0122 CBP bromodomain TR-FRET Assay Kit Inquiry
Related Gene / Proteins
CREB CREB3 crebbp CRISP1
CRISP3 CRP

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.