Recombinant Human DAZ3 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2544
Background:  RNA-binding protein that plays an essential role in spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  DAZ3/DAZ3_HUMAN/deleted in azoospermia 3
Tag:  GST
Amino Acid Sequence:  YPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQR RD
Sequence Similarities:  Belongs to the RRM DAZ family.Contains 12 DAZ-like domains.Contains 1 RRM (RNA recognition motif) domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 387 to 438
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.