Recombinant Human DAZAP1 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2542
Background:  RNA-binding protein, which may be required during spermatogenesis.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  DAZ associated protein 1/DAZ-associated protein 1/Dazap1
Tag:  GST
Amino Acid Sequence:  GVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLS GFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Sequence Similarities:  Contains 2 RRM (RNA recognition motif) domains.
Expression System:  Wheat germ
Post Translational Modifications:  Phosphorylated upon DNA damage, probably by ATM or ATR.
Protein Length:  Protein fragment; 308 to 407
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.