Recombinant Human DDX18 protein


  • Specification
  • Related Products
Cat.No.:  PE-2540
Product Name:  Recombinant Human DDX18 protein
Background:  Probable RNA-dependent helicase.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  ATP dependent RNA helicase DDX18/ATP-dependent RNA helicase DDX18/DDX 18
Tag:  GST
Amino Acid Sequence:  KNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPF VDLNVNSNEGKQKKRGGGGGFGYQKTKKVEKSKIFKHISKKSSDSRQFSH
Sequence Similarities:  Belongs to the DEAD box helicase family. DDX18/HAS1 subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 571 to 670
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.