| Cat.No.: | PE-2540 |
| Product Name: | Recombinant Human DDX18 protein |
| Background: | Probable RNA-dependent helicase. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | ATP dependent RNA helicase DDX18/ATP-dependent RNA helicase DDX18/DDX 18 |
| Tag: | GST |
| Amino Acid Sequence: | KNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPF VDLNVNSNEGKQKKRGGGGGFGYQKTKKVEKSKIFKHISKKSSDSRQFSH |
| Sequence Similarities: | Belongs to the DEAD box helicase family. DDX18/HAS1 subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 571 to 670 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0055 | Phospho-DDX3X (Thr322) Polyclonal Antibody | Inquiry |
| EAb-0306 | DDX43 Polyclonal Antibody | Inquiry |
| EAb-0307 | DDB2 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0057 | Recombinant Human DDX20 293 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0178 | Human RIG-I/DDX58 peptide | Inquiry |
| Related Gene / Proteins | |||
| DDB2 | Ddit3 | DDX10 | DDX18 |
| DDX20 | DDX28 | DDX3X | DDX41 |
| DDX42 | DDX43 | DDX49 | DDX50 |
| DDX58 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools