Recombinant Human DDX41 protein


  • Specification
  • Related Products
Cat.No.:  PE-2537
Background:  Probable ATP-dependent RNA helicase. Is required during post-transcriptional gene expression. May be involved in pre-mRNA splicing.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  2900024F02Rik/AA958953/ABS
Tag:  GST
Amino Acid Sequence:  TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDES MLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF
Sequence Similarities:  Belongs to the DEAD box helicase family. DDX41 subfamily.Contains 1 CCHC-type zinc finger.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 523 to 622
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart