Recombinant Human DENND4A protein


  • Specification
  • Related Products
Cat.No.:  PE-2533
Product Name:  Recombinant Human DENND4A protein
Background:  Binds to ISRE-like element (interferon-stimulated response element) of MYC P2 promoter.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  C-myc promoter-binding protein/DENN domain-containing protein 4A/DENN/MADD domain containing 4A
Tag:  GST
Amino Acid Sequence:  MIEDKGPRVADYFVVAGLTDVSKPLEEEIHFNDACHKVAKPKEPITDVSV IIKSLGEEVPQDYICIDVTPTGLSADLNNGSLVGPQIYLCYRRGRDKPPL T
Sequence Similarities:  Contains 1 dDENN domain.Contains 1 DENN domain.Contains 1 MABP domain.Contains 2 PPR (pentatricopeptide) repeats.Contains 1 uDENN domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 1 to 101
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Extracts & Lysates
EL-0207 Recombinant Human DEK 293 Cell Lysate Inquiry
◆ Cell Lines
CL-0243 Human DEPDC1B Knockout Cell Line Inquiry
◆ Proteins & Enzymes
PE-1428 Recombinant Human DEK, GST-tagged Inquiry
PE-1429 Recombinant Chicken DEK Inquiry
PE-1430 Recombinant Zebrafish DEK Inquiry
Related Gene / Proteins
DEK DENND4A DEPDC1B

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.