| Cat.No.: | PE-2529 |
| Background: | Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DP2/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F-1/DP complex appears to mediate both cell proliferation and apoptosis. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | DP2/E2F dimerization partner 2/Tfdp2 |
| Tag: | GST |
| Amino Acid Sequence: | MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF IDSDFSESKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSE FTNSNNHLAA |
| Sequence Similarities: | Belongs to the E2F/DP family. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Ser-24 is probably phosphorylated by CDK2. |
| Protein Length: | Protein fragment; 1 to 110 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0099 | Human DPEP1 Knockout Cell Line | Inquiry |
| CL-0102 | Human DPEP3 Knockout Cell Line | Inquiry |
| ◆ Antibodies | ||
| EAb-0974 | DPY30 Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-0975 | DPY30 Polyclonal Antibody, FITC Conjugated | Inquiry |
| EAb-0976 | DPY30 Polyclonal Antibody, Biotin Conjugated | Inquiry |
| Related Gene / Proteins | |||
| DP1 | DP2 | DPEP1 | DPEP3 |
| DPF3 | DPY30 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.