Recombinant Human ENDOGL1/ENGL protein


  • Specification
  • Related Products
Cat.No.:  PE-2527
Background:  Endo/exonuclease with nicking activity towards supercoiled DNA, a preference for single stranded DNA and 5'-3' exonuclease activity.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Endo G like 1/Endo G-like 1/Endo/exonuclease (5'-3'), endonuclease G like
Tag:  GST
Amino Acid Sequence:  LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEG ARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS
Sequence Similarities:  Belongs to the DNA/RNA non-specific endonuclease family.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 269 to 368
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart