Cat.No.: | PE-2519 |
Product Name: | Recombinant Human GATAD2A protein |
Background: | Transcriptional repressor. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | FLJ20085/FLJ21017/GATA zinc finger domain containing 2A |
Tag: | GST |
Amino Acid Sequence: | QIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSV IPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPL LLAPRASVP |
Sequence Similarities: | Contains 1 GATA-type zinc finger. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 26 to 134 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0023 | Human GATAD2B Knockout Cell Line | Inquiry |
CL-0202 | Human GABRG2 Knockout Cell Line | Inquiry |
CL-0468 | Human GATAD2B Knockout Cell Line | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0292 | Gemcitabine | Inquiry |
BSM-0378 | Gemcitabine-13C,15N2 (hydrochloride) | Inquiry |
Related Gene / Proteins | |||
GABRG2 | Gadd45a | GAR | GASC1 |
GATA-1 | GATA-4 | GATA-6 | GATAD2A |
GATAD2B |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools