Recombinant Human GATAD2A protein


  • Specification
  • Related Products
Cat.No.:  PE-2519
Product Name:  Recombinant Human GATAD2A protein
Background:  Transcriptional repressor.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  FLJ20085/FLJ21017/GATA zinc finger domain containing 2A
Tag:  GST
Amino Acid Sequence:  QIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSV IPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPL LLAPRASVP
Sequence Similarities:  Contains 1 GATA-type zinc finger.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 26 to 134
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.