Recombinant Human HAGE protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2510
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Cancer/testis antigen 13/CT13/DDX43
Tag:  GST
Amino Acid Sequence:  SHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRW RGTSRPPEAVAAGHEELPLCFALKSHFVGAVIGRGGSKI
Sequence Similarities:  Belongs to the DEAD box helicase family.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 1 KH domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 2 to 90
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.