Recombinant Human hnRNP G-T protein


  • Specification
  • Related Products
Cat.No.:  PE-2506
Product Name:  Recombinant Human hnRNP G-T protein
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Heterogeneous nuclear ribonucleoprotein G T/hnRNP G T/hnRNP G-T
Tag:  GST
Amino Acid Sequence:  MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRG FAFVTFESPADAKAAARDMNGKSLDGKAIKVAQATKPAFE
Sequence Similarities:  Contains 1 RRM (RNA recognition motif) domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 1 to 90
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.