Recombinant Human hSSB1 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2500
Background:  Single-stranded DNA (ssDNA)-binding proteins, such as hSSB1, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage. hSSB1 plays an important role in DNA damage response. It influences diverse endpoints in the cellular DNA damage response, including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. It associates with DNA lesions, and enables the efficient activation of ATM and consequent phosphorylation of downstream proteins.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  2610036N15Rik/hSSB1/LP3587
Tag:  GST
Amino Acid Sequence:  MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSI NISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCM VYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPSAASPASENQ NGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVS NGKETRRSSKR
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 211
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Cell Lines
CL-0027 Human HSPBAP1 Knockout Cell Line Inquiry
◆ Bioactive Small Molecules
BSM-0337 BIIB021 Inquiry
◆ Antibodies
EAb-1959 HSC70 / HSP7C Monoclonal Antibody Inquiry
EAb-1960 HSP72 Monoclonal Antibody Inquiry
◆ Proteins & Enzymes
PE-2336 Recombinant Human HSPBAP1 protein Inquiry
Related Gene / Proteins
HSC70 HSF4 HSP72 Hsp90
HSPBAP1 hSSB1

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.