Recombinant Human MAFF protein


  • Specification
  • Related Products
Cat.No.:  PE-2493
Product Name:  Recombinant Human MAFF protein
Background:  Interacts with the upstream promoter region of the oxytocin receptor gene. May be a transcriptional enhancer in the up-regulation of the oxytocin receptor gene at parturition. Since it lacks a putative transactivation domain, it may behave as a transcriptional repressor when it dimerize among himself. May also serve as a transcriptional activator by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. May be involved in the cellular stress response.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Avian musculoaponeurotic fibrosarcoma virus (v maf) AS42 oncogene, protein F/CTA 447C4.1/hMafF
Tag:  GST
Amino Acid Sequence:  MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVT RLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAM RLELDALRGK
Sequence Similarities:  Belongs to the bZIP family. Maf subfamily.Contains 1 bZIP domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 1 to 110
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.