Recombinant Human MCM8 protein


  • Specification
  • Related Products
Cat.No.:  PE-2491
Product Name:  Recombinant Human MCM8 protein
Background:  Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. May also play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G(1) phase by recruiting CDC6 to the origin recognition complex (ORC). Binds chromatin throughout the cell cycle.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  C20orf154/dJ967N21.5/DNA helicase MCM8
Tag:  GST
Amino Acid Sequence:  TYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQL RQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM
Sequence Similarities:  Belongs to the MCM family.Contains 1 MCM domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 646 to 735
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Cell Lines
CL-0011 Human MCF2L Knockout Cell Line Inquiry
◆ Antibodies
EAb-0068 MCAF Polyclonal Antibody Inquiry
EAb-0303 MCM6 Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0161 Recombinant Human MCRS1 293 Cell Lysate Inquiry
◆ Proteins & Enzymes
PE-1225 Recombinant Human MCRS1, His-tagged Inquiry
Related Gene / Proteins
MCAF1 MCF2L MCM6 MCM8
MCRS1

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.