Cat.No.: | PE-2488 |
Product Name: | Recombinant Human MEX3B protein |
Background: | RNA-binding protein. May be involved in post-transcriptional regulatory mechanisms. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | KIAA2009/mex3b/MEX3B_HUMAN |
Tag: | GST |
Amino Acid Sequence: | RKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEP VFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPG |
Sequence Similarities: | Contains 2 KH domains.Contains 1 RING-type zinc finger. |
Expression System: | Wheat germ |
Post Translational Modifications: | Phosphorylated. |
Protein Length: | Protein fragment; 60 to 159 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0043 | Recombinant Human MECP2 293 Cell Lysate | Inquiry |
EL-0111 | Recombinant Human MEF2B Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0067 | MeCP2 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0109 | Human MECP2 Knockout Cell Line 1bp insertion | Inquiry |
CL-0110 | Human MEN1 Knockout Cell Line 1bp insertion | Inquiry |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools