Recombinant Human MEX3B protein


  • Specification
  • Related Products
Cat.No.:  PE-2488
Product Name:  Recombinant Human MEX3B protein
Background:  RNA-binding protein. May be involved in post-transcriptional regulatory mechanisms.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  KIAA2009/mex3b/MEX3B_HUMAN
Tag:  GST
Amino Acid Sequence:  RKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEP VFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPG
Sequence Similarities:  Contains 2 KH domains.Contains 1 RING-type zinc finger.
Expression System:  Wheat germ
Post Translational Modifications:  Phosphorylated.
Protein Length:  Protein fragment; 60 to 159
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.