| Cat.No.: | PE-2488 |
| Background: | RNA-binding protein. May be involved in post-transcriptional regulatory mechanisms. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | KIAA2009/mex3b/MEX3B_HUMAN |
| Tag: | GST |
| Amino Acid Sequence: | RKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEP VFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPG |
| Sequence Similarities: | Contains 2 KH domains.Contains 1 RING-type zinc finger. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated. |
| Protein Length: | Protein fragment; 60 to 159 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0043 | Recombinant Human MECP2 293 Cell Lysate | Inquiry |
| EL-0111 | Recombinant Human MEF2B Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0067 | MeCP2 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0109 | Human MECP2 Knockout Cell Line 1bp insertion | Inquiry |
| CL-0110 | Human MEN1 Knockout Cell Line 1bp insertion | Inquiry |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.