| Cat.No.: | PE-2486 |
| Product Name: | Recombinant Human MEX3D protein |
| Background: | RNA binding protein, may be involved in post-transcriptional regulatory mechanisms. There are two isoforms. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | bcl-2 ARE RNA binding protein/mex 3 homolog D (C. elegans)/MEX 3D |
| Tag: | GST |
| Amino Acid Sequence: | LARECVVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQ AIRVETETPQPGGASALQRQY |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 418 to 488 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0043 | Recombinant Human MECP2 293 Cell Lysate | Inquiry |
| EL-0111 | Recombinant Human MEF2B Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0067 | MeCP2 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0109 | Human MECP2 Knockout Cell Line 1bp insertion | Inquiry |
| CL-0110 | Human MEN1 Knockout Cell Line 1bp insertion | Inquiry |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
