Recombinant Human MEX3D protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2486
Background:  RNA binding protein, may be involved in post-transcriptional regulatory mechanisms. There are two isoforms.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  bcl-2 ARE RNA binding protein/mex 3 homolog D (C. elegans)/MEX 3D
Tag:  GST
Amino Acid Sequence:  LARECVVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQ AIRVETETPQPGGASALQRQY
Expression System:  Wheat germ
Protein Length:  Protein fragment; 418 to 488
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.