| Cat.No.: | PE-2468 |
| Background: | Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 2010208O10Rik/2310034K10Rik/FLJ12710 |
| Tag: | GST |
| Amino Acid Sequence: | MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMV LEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV |
| Sequence Similarities: | Belongs to the snRNP Sm proteins family. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 91 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Research Kits | ||
| EKIT-0062 | Histone Demethylase LSD1 Activity/Inhibition Assay Kit | Inquiry |
| EKIT-0126 | LSD1 Inhibitor Screening Assay Kit | Inquiry |
| EKIT-0160 | LSD1 Demethylase Activity/Inhibition Fluorometric Assay Kit | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0111 | DDP-38003 dihydrochloride | Inquiry |
| BSM-0141 | GSK-LSD1 dihydrochloride | Inquiry |
| Related Gene / Proteins | |||
| LSD1 | LSD2 | LSM2 | LSM3 |
| LSM5 | LSM6 | LSP1 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.