Recombinant Human LSM5 protein


  • Specification
  • Related Products
Cat.No.:  PE-2468
Product Name:  Recombinant Human LSM5 protein
Background:  Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  2010208O10Rik/2310034K10Rik/FLJ12710
Tag:  GST
Amino Acid Sequence:  MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMV LEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
Sequence Similarities:  Belongs to the snRNP Sm proteins family.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 91
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.