Recombinant Human PCNA protein


  • Specification
  • Related Products
Cat.No.:  PE-2463
Product Name:  Recombinant Human PCNA protein
Background:  This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2.
Applications:  SDS-PAGE; Western blot; ELISA; Dot blot; Functional Studies
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  29 kDa
Purity:  > 98 % SDS-PAGE.
Species:  Human
Formulation:  pH: 7.9; Constituents: 0.6% HEPES, 0.03% EDTA, 0.01% Tergitol-NP40, 0.02% DTT, 0.0002% Leupeptin, 0.002% PMSF, 0.44% Sodium chloride, 50% Glycerol
Accession#:  P12004
Alternative Names:  ATLD2/cb16/Cyclin
Amino Acid Sequence:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQL TLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLA LVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRD LSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMN EPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYY LAPKIEDEEGS
Sequence Similarities:  Belongs to the PCNA family.
Expression System:  E. coli
Post Translational Modifications:  Upon methyl methanesulfonate-induced DNA damage, mono-ubiquitinated by the UBE2B-RAD18 complex on Lys-164. This induces non-canonical polyubiquitination on Lys-164 through 'Lys-63' linkage of ubiquitin moieties by the E2 complex UBE2N-UBE2V2 and the E3 ligases, HLTF, RNF8 and SHPRH, which is required for DNA repair. 'Lys-63' polyubiquitination prevents genomic instability on DNA damage. Monoubiquitination at Lys-164 also takes place in undamaged proliferating cells, and is mediated by the DCX(DTL) complex, leading to enhance PCNA-dependent translesion DNA synthesis.Acetylated in response to UV irradiation. Acetylation disrupts interaction with NUDT15 and promotes degradation.
Protein Length:  Full length protein; 1 to 261
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Bioactive Small Molecules
BSM-0039 Embelin Inquiry
BSM-0108 Curcumin, Curcuma longa (High Purity) Inquiry
BSM-0133 Garcinol Inquiry
◆ Antibodies
EAb-0060 PCAF Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0106 Recombinant Human PCNA Cell Lysate Inquiry
Related Gene / Proteins
PCAF PCBP2 PCBP3 PCBP4
PCGF2 PCGF6 PCL2 PCNA

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.