Recombinant Human C Reactive Protein (denatured)


  • Specification
  • Related Products
Cat.No.:  PE-2461
Product Name:  Recombinant Human C Reactive Protein (denatured)
Background:  Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  23 kDa including tags
Purity:  > 90 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.00; Constituents: 20% Glycerol, 12.01% Urea. Note: Contains 67% Tris-HCl buffer.
Accession#:  P02741
Alternative Names:  Pentraxin 1, short/C reactive protein/C reactive protein pentraxin related
Amino Acid Sequence:  MQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGY SIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTS WESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGS QSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVF TKPQLWP
Sequence Similarities:  Belongs to the pentaxin family.Contains 1 pentaxin domain.
Expression System:  E. coli
Protein Length:  Full length protein; 19 to 244
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.