Cat.No.: | PE-2461 |
Product Name: | Recombinant Human C Reactive Protein (denatured) |
Background: | Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. |
Applications: | SDS-PAGE |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 23 kDa including tags |
Purity: | > 90 % SDS-PAGE. |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 20% Glycerol, 12.01% Urea. Note: Contains 67% Tris-HCl buffer. |
Accession#: | P02741 |
Alternative Names: | Pentraxin 1, short/C reactive protein/C reactive protein pentraxin related |
Amino Acid Sequence: | MQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGY SIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTS WESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGS QSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVF TKPQLWP |
Sequence Similarities: | Belongs to the pentaxin family.Contains 1 pentaxin domain. |
Expression System: | E. coli |
Protein Length: | Full length protein; 19 to 244 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-1866 | PELP1 Polyclonal Antibody | Inquiry |
◆ Proteins & Enzymes | ||
PE-2183 | Recombinant Human Peregrin/BRPF1 protein | Inquiry |
PE-2278 | Recombinant Human Peregrin/BRPF1 protein | Inquiry |
PE-2461 | Recombinant Human C Reactive Protein (denatured) | Inquiry |
PE-2642 | Recombinant Human C Reactive Protein | Inquiry |
Related Gene / Proteins | |||
PELP1 | Pentraxin | Peregrin |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools