| Cat.No.: | PE-2461 |
| Background: | Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 23 kDa including tags |
| Purity: | > 90 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 20% Glycerol, 12.01% Urea. Note: Contains 67% Tris-HCl buffer. |
| Accession#: | P02741 |
| Alternative Names: | Pentraxin 1, short/C reactive protein/C reactive protein pentraxin related |
| Amino Acid Sequence: | MQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGY SIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTS WESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGS QSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVF TKPQLWP |
| Sequence Similarities: | Belongs to the pentaxin family.Contains 1 pentaxin domain. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 19 to 244 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-1866 | PELP1 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2183 | Recombinant Human Peregrin/BRPF1 protein | Inquiry |
| PE-2278 | Recombinant Human Peregrin/BRPF1 protein | Inquiry |
| PE-2461 | Recombinant Human C Reactive Protein (denatured) | Inquiry |
| PE-2642 | Recombinant Human C Reactive Protein | Inquiry |
| Related Gene / Proteins | |||
| PELP1 | Pentraxin | Peregrin | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.