Recombinant Human CBX1 / HP1 beta protein


  • Specification
  • Related Products
Cat.No.:  PE-2459
Product Name:  Recombinant Human CBX1 / HP1 beta protein
Background:  Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane.
Applications:  SDS-PAGE; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  24 kDa including tags
Purity:  > 85 % SDS-PAGE. Purified using conventional chromatography techniques.
Species:  Human
Formulation:  Constituents: 20% Glycerol, 0.316% Tris HCl, 0.058% Sodium chloride, 0.0308% DTT, pH 8.0
Accession#:  P83916
Alternative Names:  CBX/CBX 1/Cbx1
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMGKKQNKKKVEEVLEEEEEEYVVEKVLDRR VVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS EGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSG ELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDK KDDKN
Sequence Similarities:  Contains 2 chromo domains.
Expression System:  E. coli
Post Translational Modifications:  Not phosphorylated.Ubiquitinated.
Protein Length:  Full length protein; 1 to 185
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.