| Cat.No.: | PE-2459 |
| Background: | Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane. |
| Applications: | SDS-PAGE; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 24 kDa including tags |
| Purity: | > 85 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | Constituents: 20% Glycerol, 0.316% Tris HCl, 0.058% Sodium chloride, 0.0308% DTT, pH 8.0 |
| Accession#: | P83916 |
| Alternative Names: | CBX/CBX 1/Cbx1 |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGKKQNKKKVEEVLEEEEEEYVVEKVLDRR VVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS EGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSG ELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDK KDDKN |
| Sequence Similarities: | Contains 2 chromo domains. |
| Expression System: | E. coli |
| Post Translational Modifications: | Not phosphorylated.Ubiquitinated. |
| Protein Length: | Full length protein; 1 to 185 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0051 | Human CBX1 Knockout Cell Line 32bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0082 | HP1α, β and γ Polyclonal Antibody | Inquiry |
| EAb-0083 | HP1α Polyclonal Antibody | Inquiry |
| EAb-0149 | CBX1 Polyclonal Antibody | Inquiry |
| EAb-0677 | CBX1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HP1 | HP1BP3 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.
