| Cat.No.: | PE-2454 |
| Product Name: | Recombinant Human PARK7/DJ1 protein |
| Background: | Protects cells against oxidative stress and cell death. Plays a role in regulating expression or stability of the mitochondrial uncoupling proteins SLC25A14 and SLC25A27 in dopaminergic neurons of the substantia nigra pars compacta and attenuates the oxidative stress induced by calcium entry into the neurons via L-type channels during pacemaking. Eliminates hydrogen peroxide and protects cells against hydrogen peroxide-induced cell death. May act as an atypical peroxiredoxin-like peroxidase that scavenges hydrogen peroxide. Following removal of a C-terminal peptide, displays protease activity and enhanced cytoprotective action against oxidative stress-induced apoptosis. Stabilizes NFE2L2 by preventing its association with KEAP1 and its subsequent ubiquitination. Binds to OTUD7B and inhibits its deubiquitinating activity. Enhances RELA nuclear translocation. Binds to a number of mRNAs containing multiple copies of GG or CC motifs and partially inhibits their translation but dissociates following oxidative stress. Required for correct mitochondrial morphology and function and for autophagy of dysfunctional mitochondria. Regulates astrocyte inflammatory responses. Acts as a positive regulator of androgen receptor-dependent transcription. Prevents aggregation of SNCA. Plays a role in fertilization. Has no proteolytic activity. Has cell-growth promoting activity and transforming activity. May function as a redox-sensitive chaperone. |
| Applications: | Western blot; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 22 kDa including tags |
| Purity: | > 85 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 7.00; Preservative: 1.02% Imidazole; Constituents: 0.002% PMSF, 0.7% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.76% Sodium chloride |
| Accession#: | Q99497 |
| Alternative Names: | CAP1/DJ-1/DJ1 |
| Tag: | His |
| Amino Acid Sequence: | TVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYD VVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIG FGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAI VEALNGKEVAAQVKAPLVLKD |
| Sequence Similarities: | Belongs to the peptidase C56 family. |
| Expression System: | E. coli |
| Post Translational Modifications: | Sumoylated on Lys-130 by PIAS2 or PIAS4; which is enhanced after ultraviolet irradiation and essential for cell-growth promoting activity and transforming activity.Cys-106 is easily oxidized to sulfinic acid.Undergoes cleavage of a C-terminal peptide and subsequent activation of protease activity in response to oxidative stress. |
| Protein Length: | Protein fragment; 19 to 189 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0059 | PARP Monoclonal Antibody | Inquiry |
| EAb-0061 | PARP Polyclonal Antibody | Inquiry |
| EAb-0062 | PARP (Cleaved) Polyclonal Antibody | Inquiry |
| EAb-0063 | PARP (Cleaved) Polyclonal Antibody | Inquiry |
| EAb-0064 | Paf1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| DJ1 | PABPC1L2A | PABPC5 | PABPN1 |
| PAD | PAD1 | PAD2 | PAD3 |
| PAD4 | PADI1 | PADI2 | PADI3 |
| PADI4 | PADI6 | PAF1 | PAN2 |
| PAPD1 | PAPD4 | PAPD5 | PAPD7 More > |
| PAPOLA | PAPOLB | PARD6A | PARG |
| PARK2 | PARK7 | PARP | PARP1 |
| PARP10 | PARP11 | PARP12 | PARP14 |
| PARP15 | PARP16 | PARP2 | PARP3 |
| PARP4 | PARP6 | PARP7 | PARP8 |
| PARP9 | PAX5 | PAX6 | PAX7 |
| PAX9 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools