Cat.No.: | PE-2452 |
Product Name: | Recombinant Human UBE2C protein |
Background: | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit. |
Applications: | Western blot; SDS-PAGE |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 21 kDa including tags |
Purity: | > 95 % SDS-PAGE. |
Species: | Human |
Formulation: | pH: 7.00; Preservative: 1.02% Imidazole; Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.04% DTT, 25% Glycerol, 1.76% Sodium chloride |
Accession#: | O00762 |
Alternative Names: | Cyclin selective ubiquitin carrier protein/dJ447F3.2/Mitotic specific ubiquitin conjugating enzyme |
Tag: | His |
Amino Acid Sequence: | MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGI SAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLT PCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT HAAELWKNPTAFKKYLQETYSKQVTSQEP |
Sequence Similarities: | Belongs to the ubiquitin-conjugating enzyme family. |
Expression System: | E. coli |
Post Translational Modifications: | Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates have been destroyed. |
Protein Length: | Full length protein; 1 to 179 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0026 | Human UBAP1 Knockout Cell Line | Inquiry |
◆ Synthetic Peptides | ||
SP-0162 | Synthetic Human Ubiquitin protein (Biotin) | Inquiry |
SP-0163 | Human Ubiquitin peptide | Inquiry |
◆ Antibodies | ||
EAb-0174 | UBE2G1 Polyclonal Antibody | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0315 | NSC 697923 | Inquiry |
Related Gene / Proteins | |||
UB2D1 | UB2D2 | UB2D3 | UB2R1 |
UBA1 | UBA5 | UBA7 | UBAP1 |
UBB | UBC | UBC12 | Ubc13 |
Ubc3B | UbcH1 | UbcH2 | UbcH3 |
UbcH5a | UbcH5b | UbcH5c | UbcH8 More > |
UBD | UBE1L | UBE2B | UBE2C |
UBE2D1 | UBE2D3 | UBE2DNL | UBE2E1 |
UBE2E2 | UBE2E3 | UBE2G1 | UBE2G2 |
UBE2H | UBE2I | UBE2K | UBE2L3 |
UBE2L6 | UBE2M | UBE2N | UBE2O |
UBE2Q2 | UBE2R1 | UBE2R2 | UBE2T |
UBE2V1 | UBE2V2 | UBE2W | UBE3A |
Ube4a | Ubiquitin | UBL7 | Ubn1 |
UBP5 | UBR2 | UBTD1 | UBTD2 |
UBXN10 | UBXN2B | UBXN6 | UBXN8 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools