Recombinant Human UBE2E3 protein


  • Specification
  • Related Products
Cat.No.:  PE-2449
Product Name:  Recombinant Human UBE2E3 protein
Background:  Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.
Applications:  Western blot; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  25 kDa including tags
Purity:  > 95 % Densitometry.
Species:  Human
Formulation:  pH: 7.00; Preservative: 1.02% Imidazole; Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.75% Sodium chloride
Accession#:  Q969T4
Alternative Names:  Homologous to yeast UBC4/5/UB2E3_HUMAN/UBC E4
Tag:  His
Amino Acid Sequence:  MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTK LSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGP PGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILK DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQ WTKRYAT
Sequence Similarities:  Belongs to the ubiquitin-conjugating enzyme family.
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 207
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.