Recombinant Human SUZ12 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2442
Background:  Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.
Applications:  ELISA; SDS-PAGE; Western blot; Other
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  37 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione
Accession#:  Q15022
Alternative Names:  ChET 9 protein/CHET9/Chromatin precipitated E2F target 9 protein
Amino Acid Sequence:  VENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLE KGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
Sequence Similarities:  Belongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.Contains 1 C2H2-type zinc finger.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 640 to 739
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.