Recombinant Human HDAC11/HD11 protein


  • Specification
  • Related Products
Cat.No.:  PE-2423
Product Name:  Recombinant Human HDAC11/HD11 protein
Background:  Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
Applications:  Functional Studies; SDS-PAGE; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  66 kDa including tags
Purity:  > 75 % SDS-PAGE.
Species:  Human
Formulation:  pH: 7.50; Constituents: 0.307% Glutathione, 0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 0.00292% EDTA, 25% Glycerol, 0.87% Sodium chloride
Accession#:  Q96DB2
Alternative Names:  FLJ22237/HD 11/HD11
Amino Acid Sequence:  MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLK EEKLLSDSMLVEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIF LPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGGFHHCSSDRGG GFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYI MDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHL PDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
Sequence Similarities:  Belongs to the histone deacetylase family.
Expression System:  Baculovirus
Protein Length:  Full length protein; 1 to 347
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.