| Cat.No.: | PE-2423 |
| Product Name: | Recombinant Human HDAC11/HD11 protein |
| Background: | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. |
| Applications: | Functional Studies; SDS-PAGE; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 66 kDa including tags |
| Purity: | > 75 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 7.50; Constituents: 0.307% Glutathione, 0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 0.00292% EDTA, 25% Glycerol, 0.87% Sodium chloride |
| Accession#: | Q96DB2 |
| Alternative Names: | FLJ22237/HD 11/HD11 |
| Amino Acid Sequence: | MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLK EEKLLSDSMLVEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIF LPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGGFHHCSSDRGG GFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYI MDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHL PDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP |
| Sequence Similarities: | Belongs to the histone deacetylase family. |
| Expression System: | Baculovirus |
| Protein Length: | Full length protein; 1 to 347 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0006 | Recombinant Human HDAC1 293 Cell Lysate | Inquiry |
| EL-0007 | Recombinant Human HDAC2 293 Cell Lysate | Inquiry |
| EL-0008 | Recombinant Human HDAC3 Cell Lysate | Inquiry |
| EL-0009 | Recombinant Human HDAC4 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0007 | Tubacin | Inquiry |
| Related Gene / Proteins | |||
| HDAC | HDAC1 | HDAC10 | HDAC11 |
| HDAC2 | HDAC3 | hdac4 | hdac5 |
| HDAC6 | hdac7 | HDAC8 | hdac9 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools