| Cat.No.: | PE-2422 |
| Product Name: | Recombinant Human KAT1 / HAT1 protein |
| Background: | Acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. May be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes. May play a role in DNA repair in response to free radical damage. |
| Applications: | Western blot; SDS-PAGE; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 62 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | O14929-2 |
| Alternative Names: | HAT 1/hat1/HAT1_HUMAN |
| Amino Acid Sequence: | MFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVD FKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWF IETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTR PRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKL RDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEIL RLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQ MNQIEISMQHEQLEESFQELVEDYRRVIERLAQE |
| Sequence Similarities: | Belongs to the HAT1 family. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 334 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0101 | HAT-3 Polyclonal Antibody | Inquiry |
| EAb-0102 | HAT-2 Polyclonal Antibody | Inquiry |
| ◆ Research Kits | ||
| EKIT-0142 | HAT (H4) Activity Fluorometric Assay Kit | Inquiry |
| EKIT-0143 | HAT Activity Colorimetric Assay Kit | Inquiry |
| EKIT-0144 | HAT Activity Fluorometric Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| HAGE | Haspin | HAT | HAT1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools