Recombinant Human KAT1 / HAT1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2422
Product Name:  Recombinant Human KAT1 / HAT1 protein
Background:  Acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. May be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes. May play a role in DNA repair in response to free radical damage.
Applications:  Western blot; SDS-PAGE; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  62 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  O14929-2
Alternative Names:  HAT 1/hat1/HAT1_HUMAN
Amino Acid Sequence:  MFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVD FKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWF IETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTR PRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKL RDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEIL RLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQ MNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
Sequence Similarities:  Belongs to the HAT1 family.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 334
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.