| Cat.No.: | PE-2419 |
| Product Name: | Recombinant Human Cdc34 protein |
| Background: | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Cooperates with the E2 UBCH5C and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Performs ubiquitin chain elongation building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. UBE2D3 acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Cooperates with the SCF(SKP2) E3 ligase complex to regulate cell proliferation through ubiquitination and degradation of MYBL2 and KIP1. Involved in ubiquitin conjugation and degradation of CREM isoform ICERIIgamma and ATF15 resulting in abrogation of ICERIIgamma- and ATF5-mediated repression of cAMP-induced transcription during both meiotic and mitotic cell cycles. Involved in the regulation of the cell cycle G2/M phase throught its targeting of the WEE1 kinase for ubiquitination and degradation. Also involved in the degradation of beta-catenin. Is target of human herpes virus 1 protein ICP0, leading to ICP0-dependent dynamic interaction with proteasomes. |
| Applications: | Western blot; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 33 kDa including tags |
| Purity: | > 75 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 7.00; Preservative: 1.02% Imidazole; Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.04% DTT, 25% Glycerol, 1.76% Sodium chloride |
| Accession#: | P49427 |
| Alternative Names: | Cdc 34/Cdc34/Cell division cycle 34 |
| Tag: | His |
| Amino Acid Sequence: | MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPN TYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPP VDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRK WKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPD EGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES |
| Sequence Similarities: | Belongs to the ubiquitin-conjugating enzyme family. |
| Expression System: | E. coli |
| Post Translational Modifications: | Autoubiquitinated. Autoubiquitination is promoted by the human herpes virus 1 protein ICP0 and leads to degradation by the Ubiquitin-proteasomal pathway.Phosphorylated by CK2. Phosphorylation of the C-terminal tail by CK2 controles the nuclear localization. |
| Protein Length: | Full length protein; 1 to 236 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0112 | Human CDKN1B Knockout Cell Line 10bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0118 | Recombinant Mouse CDK1 Cell Lysate | Inquiry |
| EL-0119 | Recombinant Human CDK1 Cell Lysate | Inquiry |
| EL-0209 | Recombinant Human CD1D & B2M Cell Lysate | Inquiry |
| EL-0210 | Recombinant Human CD1D Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| CD1D | CDA | CDC34 | CDK1 |
| CDK8 | CDK9 | CDKA1 | CDKN1B |
| CDX1 | CDY2A | CDYL | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools