Recombinant Human Cdc34 protein


  • Specification
  • Related Products
Cat.No.:  PE-2419
Product Name:  Recombinant Human Cdc34 protein
Background:  Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Cooperates with the E2 UBCH5C and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Performs ubiquitin chain elongation building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. UBE2D3 acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Cooperates with the SCF(SKP2) E3 ligase complex to regulate cell proliferation through ubiquitination and degradation of MYBL2 and KIP1. Involved in ubiquitin conjugation and degradation of CREM isoform ICERIIgamma and ATF15 resulting in abrogation of ICERIIgamma- and ATF5-mediated repression of cAMP-induced transcription during both meiotic and mitotic cell cycles. Involved in the regulation of the cell cycle G2/M phase throught its targeting of the WEE1 kinase for ubiquitination and degradation. Also involved in the degradation of beta-catenin. Is target of human herpes virus 1 protein ICP0, leading to ICP0-dependent dynamic interaction with proteasomes.
Applications:  Western blot; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  33 kDa including tags
Purity:  > 75 % SDS-PAGE.
Species:  Human
Formulation:  pH: 7.00; Preservative: 1.02% Imidazole; Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.04% DTT, 25% Glycerol, 1.76% Sodium chloride
Accession#:  P49427
Alternative Names:  Cdc 34/Cdc34/Cell division cycle 34
Tag:  His
Amino Acid Sequence:  MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPN TYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPP VDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRK WKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPD EGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
Sequence Similarities:  Belongs to the ubiquitin-conjugating enzyme family.
Expression System:  E. coli
Post Translational Modifications:  Autoubiquitinated. Autoubiquitination is promoted by the human herpes virus 1 protein ICP0 and leads to degradation by the Ubiquitin-proteasomal pathway.Phosphorylated by CK2. Phosphorylation of the C-terminal tail by CK2 controles the nuclear localization.
Protein Length:  Full length protein; 1 to 236
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.